Lineage for d2wjzb_ (2wjz B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1358417Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 1358418Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
    contains a catalytic Cys-His-Glu triad
  6. 1358493Protein GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF [69447] (3 species)
  7. 1358503Species Thermotoga maritima [TaxId:2336] [69448] (5 PDB entries)
  8. 1358508Domain d2wjzb_: 2wjz B: [169387]
    Other proteins in same PDB: d2wjza_, d2wjzc_, d2wjze_
    automated match to d1gpwd_
    complexed with po4; mutant

Details for d2wjzb_

PDB Entry: 2wjz (more details), 2.6 Å

PDB Description: Crystal structure of (HisH) K181A Y138A mutant of imidazoleglycerolphosphate synthase (HisH HisF) which displays constitutive glutaminase activity
PDB Compounds: (B:) imidazole glycerol phosphate synthase subunit hish

SCOPe Domain Sequences for d2wjzb_:

Sequence, based on SEQRES records: (download)

>d2wjzb_ c.23.16.1 (B:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]}
mrigiisvgpgnimnlyrgvkrasenfedvsielvesprndlydllfipgvghfgegmrr
lrendlidfvrkhvederyvvgvclgmqllfeeseeapgvkglsliegnvvklrsrrlph
mgwnevifkdtfpngyyafvhtyravceeehvlgtteydgeifpsavrkgrilgfqfhpe
asskigrkllekviecsl

Sequence, based on observed residues (ATOM records): (download)

>d2wjzb_ c.23.16.1 (B:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]}
mrigiisvgpgnimnlyrgvkrasenfedvsielvesprydllfipgvhfgegmrrlren
dlidfvrkhvederyvvgvclgmqllfeeseapgvkglsliegnvvklrsrrlphmgwne
vifkdtfpngyyafvhtyravceeehvlgtteydgeifpsavrkgrilgfqfhpeasski
grkllekviecsl

SCOPe Domain Coordinates for d2wjzb_:

Click to download the PDB-style file with coordinates for d2wjzb_.
(The format of our PDB-style files is described here.)

Timeline for d2wjzb_: