Lineage for d2wjza_ (2wjz A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826663Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2826664Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 proteins)
    structural evidence for the gene duplication within the barrel fold
    automatically mapped to Pfam PF00977
  6. 2826714Protein automated matches [190186] (9 species)
    not a true protein
  7. 2826741Species Thermotoga maritima [TaxId:2336] [186925] (3 PDB entries)
  8. 2826745Domain d2wjza_: 2wjz A: [169386]
    Other proteins in same PDB: d2wjzb_, d2wjzd_, d2wjzf_
    automated match to d1gpwa_
    complexed with po4; mutant

Details for d2wjza_

PDB Entry: 2wjz (more details), 2.6 Å

PDB Description: Crystal structure of (HisH) K181A Y138A mutant of imidazoleglycerolphosphate synthase (HisH HisF) which displays constitutive glutaminase activity
PDB Compounds: (A:) imidazole glycerol phosphate synthase hisf

SCOPe Domain Sequences for d2wjza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wjza_ c.1.2.1 (A:) automated matches {Thermotoga maritima [TaxId: 2336]}
mlakriiacldvkdgrvvkgtnfenlrdsgdpvelgkfyseigidelvflditasvekrk
tmlelvekvaeqidipftvgggihdfetaselilrgadkvsintaavenpslitqiaqtf
gsqavvvaidakrvdgefmvftysgkkntgillrdwvvevekrgageilltsidrdgtks
gydtemirfvrplttlpiiasggagkmehfleaflagadaalaasvfhfreidvrelkey
lkkhgvnvrle

SCOPe Domain Coordinates for d2wjza_:

Click to download the PDB-style file with coordinates for d2wjza_.
(The format of our PDB-style files is described here.)

Timeline for d2wjza_: