Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) automatically mapped to Pfam PF00124 |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
Protein automated matches [190224] (5 species) not a true protein |
Species Rhodopseudomonas viridis [TaxId:1079] [189054] (2 PDB entries) |
Domain d2wjnm_: 2wjn M: [169385] Other proteins in same PDB: d2wjnc_, d2wjnh1, d2wjnh2 automated match to d1dxrm_ complexed with bcb, bpb, fe2, hem, mpg, mq7, ns5 |
PDB Entry: 2wjn (more details), 1.86 Å
SCOPe Domain Sequences for d2wjnm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wjnm_ f.26.1.1 (M:) automated matches {Rhodopseudomonas viridis [TaxId: 1079]} adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg aapdypaylpatpdpaslpgapk
Timeline for d2wjnm_:
View in 3D Domains from other chains: (mouse over for more information) d2wjnc_, d2wjnh1, d2wjnh2, d2wjnl_ |