Lineage for d2wjnm_ (2wjn M:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1457799Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 1457800Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 1457801Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 1457967Protein automated matches [190224] (5 species)
    not a true protein
  7. 1458039Species Rhodopseudomonas viridis [TaxId:1079] [189054] (2 PDB entries)
  8. 1458041Domain d2wjnm_: 2wjn M: [169385]
    Other proteins in same PDB: d2wjnc_, d2wjnh1, d2wjnh2
    automated match to d1dxrm_
    complexed with bcb, bpb, fe2, hem, mpg, mq7, ns5

Details for d2wjnm_

PDB Entry: 2wjn (more details), 1.86 Å

PDB Description: lipidic sponge phase crystal structure of photosynthetic reaction centre from blastochloris viridis (high dose)
PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d2wjnm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wjnm_ f.26.1.1 (M:) automated matches {Rhodopseudomonas viridis [TaxId: 1079]}
adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
aapdypaylpatpdpaslpgapk

SCOPe Domain Coordinates for d2wjnm_:

Click to download the PDB-style file with coordinates for d2wjnm_.
(The format of our PDB-style files is described here.)

Timeline for d2wjnm_: