SCOPe 2.08: Domain d2wjnc_: 2wjn C:

Lineage for d2wjnc_ (2wjn C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (2 proteins)
   consists of four heme-binding repeats
   automatically mapped to Pfam PF02276

6. Protein Photosynthetic reaction centre (cytochrome subunit) [48708] (2 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [48709] (28 PDB entries)

8. Domain d2wjnc_: 2wjn C: [169383]
   Other proteins in same PDB: d2wjnh1, d2wjnh2, d2wjnl_, d2wjnm_
   automated match to d1prcc_
   complexed with bcb, bpb, fe2, hec, mpg, mq7, ns5

Details for d2wjnc_

PDB Entry: 2wjn, 1.86 Å

PDB Description: lipidic sponge phase crystal structure of photosynthetic reaction centre from blastochloris viridis (high dose)

PDB Compounds: (C:) Photosynthetic reaction center cytochrome c subunit

SCOPe Domain Sequences for d2wjnc_:

Sequence; same for both SEQRES and ATOM records:

>d2wjnc_ a.138.1.2 (C:) Photosynthetic reaction centre (cytochrome subunit) {Rhodopseudomonas viridis [TaxId: 1079]}
cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
pqadcrtchqgvtkplfgasrlkdypelgpik

Timeline for d2wjnc_:

• d2wjnc_ first appeared in SCOPe 2.01
  
• d2wjnc_ appears in SCOPe 2.07