Lineage for d2wjnc_ (2wjn C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734165Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2734166Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2734274Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (2 proteins)
    consists of four heme-binding repeats
    automatically mapped to Pfam PF02276
  6. 2734275Protein Photosynthetic reaction centre (cytochrome subunit) [48708] (2 species)
  7. 2734276Species Rhodopseudomonas viridis [TaxId:1079] [48709] (28 PDB entries)
  8. 2734281Domain d2wjnc_: 2wjn C: [169383]
    Other proteins in same PDB: d2wjnh1, d2wjnh2, d2wjnl_, d2wjnm_
    automated match to d1prcc_
    complexed with bcb, bpb, fe2, hec, mpg, mq7, ns5

Details for d2wjnc_

PDB Entry: 2wjn (more details), 1.86 Å

PDB Description: lipidic sponge phase crystal structure of photosynthetic reaction centre from blastochloris viridis (high dose)
PDB Compounds: (C:) Photosynthetic reaction center cytochrome c subunit

SCOPe Domain Sequences for d2wjnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wjnc_ a.138.1.2 (C:) Photosynthetic reaction centre (cytochrome subunit) {Rhodopseudomonas viridis [TaxId: 1079]}
cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
pqadcrtchqgvtkplfgasrlkdypelgpik

SCOPe Domain Coordinates for d2wjnc_:

Click to download the PDB-style file with coordinates for d2wjnc_.
(The format of our PDB-style files is described here.)

Timeline for d2wjnc_: