SCOPe 2.07: Domain d2wjmc_: 2wjm C:

Lineage for d2wjmc_ (2wjm C:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (2 protein domains)
   consists of four heme-binding repeats
   automatically mapped to Pfam PF02276

6. Protein Photosynthetic reaction centre (cytochrome subunit) [48708] (2 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [48709] (21 PDB entries)

8. Domain d2wjmc_: 2wjm C: [169380]
   Other proteins in same PDB: d2wjmh1, d2wjmh2, d2wjml_, d2wjmm_
   automated match to d1prcc_
   complexed with bcb, bpb, dga, fe2, hem, mpg, mq7, ns5, po4

Details for d2wjmc_

PDB Entry: 2wjm, 1.95 Å

PDB Description: lipidic sponge phase crystal structure of the photosynthetic reaction centre from blastochloris viridis (low dose)

PDB Compounds: (C:) Photosynthetic reaction center cytochrome c subunit

SCOPe Domain Sequences for d2wjmc_:

Sequence; same for both SEQRES and ATOM records:

>d2wjmc_ a.138.1.2 (C:) Photosynthetic reaction centre (cytochrome subunit) {Rhodopseudomonas viridis [TaxId: 1079]}
cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
pqadcrtchqgvtkplfgasrlkdypelgpik

Timeline for d2wjmc_:

• d2wjmc_ first appeared in SCOPe 2.01
  
• d2wjmc_ appears in SCOPe 2.06