| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
| Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
| Protein automated matches [190091] (11 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188447] (418 PDB entries) |
| Domain d2wiha_: 2wih A: [169372] Other proteins in same PDB: d2wihb1, d2wihb2, d2wihd1, d2wihd2 automated match to d1vywa_ complexed with p48, so4 |
PDB Entry: 2wih (more details), 2.5 Å
SCOPe Domain Sequences for d2wiha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wiha_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
plvdmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllk
elnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqgla
fchshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillg
ckyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdy
kpsfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl
rl
Timeline for d2wiha_: