Lineage for d2wi4a_ (2wi4 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973216Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2973542Protein automated matches [190229] (13 species)
    not a true protein
  7. 2973575Species Human (Homo sapiens) [TaxId:9606] [187292] (114 PDB entries)
  8. 2973696Domain d2wi4a_: 2wi4 A: [169364]
    automated match to d1osfa_
    complexed with zz4

Details for d2wi4a_

PDB Entry: 2wi4 (more details), 2.4 Å

PDB Description: orally active 2-amino thienopyrimidine inhibitors of the hsp90 chaperone
PDB Compounds: (A:) heat shock protein, hsp 90-alpha

SCOPe Domain Sequences for d2wi4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wi4a_ d.122.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgke
lhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg
vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqt
eyleerrikeivkkhsqfigypitlfvek

SCOPe Domain Coordinates for d2wi4a_:

Click to download the PDB-style file with coordinates for d2wi4a_.
(The format of our PDB-style files is described here.)

Timeline for d2wi4a_: