| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) ![]() |
| Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins) |
| Protein automated matches [190229] (13 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187292] (114 PDB entries) |
| Domain d2wi3a_: 2wi3 A: [169363] automated match to d1osfa_ complexed with mg, zz3 |
PDB Entry: 2wi3 (more details), 1.9 Å
SCOPe Domain Sequences for d2wi3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wi3a_ d.122.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgke
lhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg
vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqt
eyleerrikeivkkhsqfigypitlfvek
Timeline for d2wi3a_: