SCOP 1.73: Domain d1unkb_: 1unk B:

Lineage for d1unkb_ (1unk B:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.2: Colicin E immunity proteins [47345] (1 family)

5. Family a.28.2.1: Colicin E immunity proteins [47346] (3 proteins)

6. Protein ImmE7 protein (Im7) [47347] (1 species)

7. Species Escherichia coli [TaxId:562] [47348] (10 PDB entries)

8. Domain d1unkb_: 1unk B: [16936]

Details for d1unkb_

PDB Entry: 1unk, 1.8 Å

PDB Description: structure of colicin e7 immunity protein

PDB Compounds: (B:) colicin e7

SCOP Domain Sequences for d1unkb_:

Sequence; same for both SEQRES and ATOM records:

>d1unkb_ a.28.2.1 (B:) ImmE7 protein (Im7) {Escherichia coli [TaxId: 562]}
melknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdn
rddspegivkeikewraangkpgfkqg

Timeline for d1unkb_:

• d1unkb_ first appeared (with stable ids) in SCOP 1.55
  
• d1unkb_ appears in SCOP 1.71
  
• d1unkb_ appears in SCOP 1.75
  
• d1unkb_ appears in the current release, SCOPe 2.08