Lineage for d2whya1 (2why A:19-298)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912237Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2912348Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2912675Family c.92.2.4: TM0189-like [142789] (4 proteins)
    Part of Pfam PF01497 that include some other superfamily members
  6. 2912706Protein automated matches [190559] (3 species)
    not a true protein
  7. 2912707Species Bacillus subtilis [TaxId:1423] [189053] (4 PDB entries)
  8. 2912709Domain d2whya1: 2why A:19-298 [169359]
    Other proteins in same PDB: d2whya2
    automated match to d2phza1
    complexed with cl, fe

Details for d2whya1

PDB Entry: 2why (more details), 1.7 Å

PDB Description: Crystal structure of the triscatecholate siderophore binding protein FeuA from Bacillus subtilis complexed with Ferri-Bacillibactin
PDB Compounds: (A:) Iron-uptake system-binding protein

SCOPe Domain Sequences for d2whya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2whya1 c.92.2.4 (A:19-298) automated matches {Bacillus subtilis [TaxId: 1423]}
kkkieyldktyevtvptdkiaitgsvesmedaklldvhpqgaisfsgkfpdmfkditdka
eptgekmepniekilemkpdvilastkfpektlqkistagttipvshissnwkenmmlla
qltgkekkakkiiadyeqdlketktkindkakdskalvirirqgniyiypeqvyfnstly
gdlglkapnevkaakaqelisleklsemnpdhifvqfsddenadkpdalkdleknpiwks
lkavkedhvyvnsvdplaqggtawskvrflkaaaekltqn

SCOPe Domain Coordinates for d2whya1:

Click to download the PDB-style file with coordinates for d2whya1.
(The format of our PDB-style files is described here.)

Timeline for d2whya1: