SCOPe 2.08: Domain d2whya1: 2why A:19-298

Lineage for d2whya1 (2why A:19-298)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families)
   contains a long alpha helical insertion in the interdomain linker

5. Family c.92.2.4: TM0189-like [142789] (4 proteins)
   Part of Pfam PF01497 that include some other superfamily members

6. Protein automated matches [190559] (3 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [189053] (4 PDB entries)

8. Domain d2whya1: 2why A:19-298 [169359]
   Other proteins in same PDB: d2whya2
   automated match to d2phza1
   complexed with cl, fe

Details for d2whya1

PDB Entry: 2why, 1.7 Å

PDB Description: Crystal structure of the triscatecholate siderophore binding protein FeuA from Bacillus subtilis complexed with Ferri-Bacillibactin

PDB Compounds: (A:) Iron-uptake system-binding protein

SCOPe Domain Sequences for d2whya1:

Sequence; same for both SEQRES and ATOM records:

>d2whya1 c.92.2.4 (A:19-298) automated matches {Bacillus subtilis [TaxId: 1423]}
kkkieyldktyevtvptdkiaitgsvesmedaklldvhpqgaisfsgkfpdmfkditdka
eptgekmepniekilemkpdvilastkfpektlqkistagttipvshissnwkenmmlla
qltgkekkakkiiadyeqdlketktkindkakdskalvirirqgniyiypeqvyfnstly
gdlglkapnevkaakaqelisleklsemnpdhifvqfsddenadkpdalkdleknpiwks
lkavkedhvyvnsvdplaqggtawskvrflkaaaekltqn

Timeline for d2whya1:

• d2whya1 first appeared in SCOPe 2.01, called d2whya_
  
• d2whya1 appears in SCOPe 2.07