Lineage for d2whma_ (2whm A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082160Family c.1.8.3: beta-glycanases [51487] (27 protein domains)
    consist of a number of sequence families
  6. 2082782Protein automated matches [190057] (26 species)
    not a true protein
  7. 2082847Species Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId:155077] [188920] (1 PDB entry)
  8. 2082848Domain d2whma_: 2whm A: [169352]
    automated match to d1odza_
    complexed with na, trs, zn; mutant

Details for d2whma_

PDB Entry: 2whm (more details), 1.5 Å

PDB Description: cellvibrio japonicus man26a e121a and e320g double mutant in complex with mannobiose
PDB Compounds: (A:) endo-1,4-beta mannanase, man26a

SCOPe Domain Sequences for d2whma_:

Sequence, based on SEQRES records: (download)

>d2whma_ c.1.8.3 (A:) automated matches {Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId: 155077]}
kpvtvklvdsqatmetrslfafmqeqrrhsimfghqhettqgltitrtdgtqsdtfnavg
dfaavygwdtlsivapkaagdivaqvkkayarggiitvsshfdnpktdtqkgvwpvgtsw
dqtpavvdslpggaynpvlngyldqvaewannlkdeqgrlipvifrlyhentgswfwwgd
kqstpeqykqlfrysveylrdvkgvrnflyayspnnfwdvteanylerypgdewvdvlgf
dtygpvadnadwfrnvvanaalvarmaeargkipvisgigirapdieaglydnqwyrkli
sglkadpdareiafllvwrnapqgvpgpngtqvphywvpanrpeninngtledfqafyad
eftafnrdieqvyqrptlivk

Sequence, based on observed residues (ATOM records): (download)

>d2whma_ c.1.8.3 (A:) automated matches {Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId: 155077]}
kpvtvklvdsqatmetrslfafmqeqrrhsimfghqhettqgltitrtdgtqsdtfnavg
dfaavygwdtlsivapkaagdivaqvkkayarggiitvsshfdnpktdtqkgvwpvgtsw
dqtpavvdslpggaynpvlngyldqvaewannlkdeqgrlipvifrlyhentgswfwwgd
kqstpeqykqlfrysveylrdvkgvrnflyayspnnfwdvteanylerypgdewvdvlgf
dtygpvadnadwfrnvvanaalvarmaeargkipvisgigirapdieaglydnqwyrkli
sglkadpdareiafllvwrnapqgvpgqvphywvpanrpeninngtledfqafyadefta
fnrdieqvyqrptlivk

SCOPe Domain Coordinates for d2whma_:

Click to download the PDB-style file with coordinates for d2whma_.
(The format of our PDB-style files is described here.)

Timeline for d2whma_: