Class a: All alpha proteins [46456] (286 folds) |
Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) core: 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.11.1: Acyl-CoA binding protein [47027] (2 families) |
Family a.11.1.0: automated matches [191596] (1 protein) not a true family |
Protein automated matches [191086] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189032] (2 PDB entries) |
Domain d2wh5f_: 2wh5 F: [169346] automated match to d1acaa_ complexed with coa, st9, ste |
PDB Entry: 2wh5 (more details), 2.6 Å
SCOPe Domain Sequences for d2wh5f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wh5f_ a.11.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qkqfqaavsviqnlpkngsyrpsyeemlrfysyykqatmgpclvprpgfwdpigrykwda wnslgkmsreeamsayitemklvaqkvid
Timeline for d2wh5f_: