SCOPe 2.05: Domain d2wh5f_: 2wh5 F:

Lineage for d2wh5f_ (2wh5 F:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
   core: 3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.11.1: Acyl-CoA binding protein [47027] (2 families)

5. Family a.11.1.0: automated matches [191596] (1 protein)
   not a true family

6. Protein automated matches [191086] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189032] (2 PDB entries)

8. Domain d2wh5f_: 2wh5 F: [169346]
   automated match to d1acaa_
   complexed with coa, st9, ste

Details for d2wh5f_

PDB Entry: 2wh5, 2.6 Å

PDB Description: Crystal structure of human acyl-CoA binding domain 4 complexed with stearoyl-CoA

PDB Compounds: (F:) acyl-coa-binding domain-containing protein 4

SCOPe Domain Sequences for d2wh5f_:

Sequence; same for both SEQRES and ATOM records:

>d2wh5f_ a.11.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qkqfqaavsviqnlpkngsyrpsyeemlrfysyykqatmgpclvprpgfwdpigrykwda
wnslgkmsreeamsayitemklvaqkvid

Timeline for d2wh5f_:

• d2wh5f_ first appeared in SCOPe 2.01
  
• d2wh5f_ appears in SCOPe 2.04
  
• d2wh5f_ appears in SCOPe 2.06
  
• d2wh5f_ appears in the current release, SCOPe 2.08