Lineage for d2wh5b_ (2wh5 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697426Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2697427Superfamily a.11.1: Acyl-CoA binding protein [47027] (2 families) (S)
  5. 2697448Family a.11.1.0: automated matches [191596] (1 protein)
    not a true family
  6. 2697449Protein automated matches [191086] (6 species)
    not a true protein
  7. 2697454Species Human (Homo sapiens) [TaxId:9606] [189032] (2 PDB entries)
  8. 2697458Domain d2wh5b_: 2wh5 B: [169342]
    automated match to d1acaa_
    complexed with coa, st9, ste

Details for d2wh5b_

PDB Entry: 2wh5 (more details), 2.6 Å

PDB Description: Crystal structure of human acyl-CoA binding domain 4 complexed with stearoyl-CoA
PDB Compounds: (B:) acyl-coa-binding domain-containing protein 4

SCOPe Domain Sequences for d2wh5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wh5b_ a.11.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qkqfqaavsviqnlpkngsyrpsyeemlrfysyykqatmgpclvprpgfwdpigrykwda
wnslgkmsreeamsayitemklvaqkvid

SCOPe Domain Coordinates for d2wh5b_:

Click to download the PDB-style file with coordinates for d2wh5b_.
(The format of our PDB-style files is described here.)

Timeline for d2wh5b_: