Lineage for d1dnya_ (1dny A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47146Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
  4. 47147Superfamily a.28.1: ACP-like [47336] (3 families) (S)
  5. 47160Family a.28.1.2: Peptidyl carrier domain [47342] (1 protein)
  6. 47161Protein Peptidyl carrier protein (PCP), thioester domain [47343] (1 species)
  7. 47162Species Bacillus brevis [TaxId:1393] [47344] (1 PDB entry)
  8. 47163Domain d1dnya_: 1dny A: [16934]

Details for d1dnya_

PDB Entry: 1dny (more details)

PDB Description: solution structure of pcp, a prototype for the peptidyl carrier domains of modular peptide synthetases

SCOP Domain Sequences for d1dnya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dnya_ a.28.1.2 (A:) Peptidyl carrier protein (PCP), thioester domain {Bacillus brevis}
yvaptnavesklaeiwervlgvsgigildnffqigghslkamavaaqvhreyqvelplkv
lfaqptikalaqyvat

SCOP Domain Coordinates for d1dnya_:

Click to download the PDB-style file with coordinates for d1dnya_.
(The format of our PDB-style files is described here.)

Timeline for d1dnya_: