Lineage for d1dnya_ (1dny A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706109Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 2706228Family a.28.1.2: Peptidyl carrier domain [47342] (1 protein)
  6. 2706229Protein Peptidyl carrier protein (PCP), thioester domain [47343] (1 species)
  7. 2706230Species Bacillus brevis [TaxId:1393] [47344] (7 PDB entries)
  8. 2706235Domain d1dnya_: 1dny A: [16934]

Details for d1dnya_

PDB Entry: 1dny (more details)

PDB Description: solution structure of pcp, a prototype for the peptidyl carrier domains of modular peptide synthetases
PDB Compounds: (A:) non-ribosomal peptide synthetase peptidyl carrier protein

SCOPe Domain Sequences for d1dnya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dnya_ a.28.1.2 (A:) Peptidyl carrier protein (PCP), thioester domain {Bacillus brevis [TaxId: 1393]}
yvaptnavesklaeiwervlgvsgigildnffqigghslkamavaaqvhreyqvelplkv
lfaqptikalaqyvat

SCOPe Domain Coordinates for d1dnya_:

Click to download the PDB-style file with coordinates for d1dnya_.
(The format of our PDB-style files is described here.)

Timeline for d1dnya_: