SCOPe 2.08: Domain d2wgwb_: 2wgw B:

Lineage for d2wgwb_ (2wgw B:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein Class D beta-lactamase [56622] (4 species)

7. Species Pseudomonas aeruginosa, OXA-10 [TaxId:287] [56623] (36 PDB entries)

8. Domain d2wgwb_: 2wgw B: [169338]
   automated match to d1k4fb_
   complexed with gol, so4; mutant

Details for d2wgwb_

PDB Entry: 2wgw, 1.8 Å

PDB Description: crystal structure of the oxa-10 v117t mutant at ph 8.0

PDB Compounds: (B:) beta-lactamase oxa-10

SCOPe Domain Sequences for d2wgwb_:

Sequence; same for both SEQRES and ATOM records:

>d2wgwb_ e.3.1.1 (B:) Class D beta-lactamase {Pseudomonas aeruginosa, OXA-10 [TaxId: 287]}
mgsitentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiigl
etgviknehqvfkwdgkpramkqwerdltlrgaiqvsatpvfqqiarevgevrmqkylkk
fsygnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaap
eylvhsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkim
esegiig

Timeline for d2wgwb_:

• d2wgwb_ first appeared in SCOPe 2.01
  
• d2wgwb_ appears in SCOPe 2.07