Lineage for d2wgwb_ (2wgw B:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3012720Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3013280Protein Class D beta-lactamase [56622] (4 species)
  7. 3013294Species Pseudomonas aeruginosa, OXA-10 [TaxId:287] [56623] (36 PDB entries)
  8. 3013310Domain d2wgwb_: 2wgw B: [169338]
    automated match to d1k4fb_
    complexed with gol, so4; mutant

Details for d2wgwb_

PDB Entry: 2wgw (more details), 1.8 Å

PDB Description: crystal structure of the oxa-10 v117t mutant at ph 8.0
PDB Compounds: (B:) beta-lactamase oxa-10

SCOPe Domain Sequences for d2wgwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wgwb_ e.3.1.1 (B:) Class D beta-lactamase {Pseudomonas aeruginosa, OXA-10 [TaxId: 287]}
mgsitentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiigl
etgviknehqvfkwdgkpramkqwerdltlrgaiqvsatpvfqqiarevgevrmqkylkk
fsygnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaap
eylvhsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkim
esegiig

SCOPe Domain Coordinates for d2wgwb_:

Click to download the PDB-style file with coordinates for d2wgwb_.
(The format of our PDB-style files is described here.)

Timeline for d2wgwb_: