| Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
| Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) ![]() |
| Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
| Protein Class D beta-lactamase [56622] (4 species) |
| Species Pseudomonas aeruginosa, OXA-10 [TaxId:287] [56623] (36 PDB entries) |
| Domain d2wgwb_: 2wgw B: [169338] automated match to d1k4fb_ complexed with gol, so4; mutant |
PDB Entry: 2wgw (more details), 1.8 Å
SCOPe Domain Sequences for d2wgwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wgwb_ e.3.1.1 (B:) Class D beta-lactamase {Pseudomonas aeruginosa, OXA-10 [TaxId: 287]}
mgsitentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiigl
etgviknehqvfkwdgkpramkqwerdltlrgaiqvsatpvfqqiarevgevrmqkylkk
fsygnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaap
eylvhsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkim
esegiig
Timeline for d2wgwb_: