Lineage for d2wgta_ (2wgt A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2776827Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2776828Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2776829Family b.21.1.1: Adenovirus fiber protein 'knob' domain [49836] (2 proteins)
    automatically mapped to Pfam PF00541
  6. 2776959Protein automated matches [190333] (6 species)
    not a true protein
  7. 2777016Species Human adenovirus 37 [TaxId:52275] [188823] (4 PDB entries)
  8. 2777019Domain d2wgta_: 2wgt A: [169329]
    automated match to d1uxaa_
    complexed with 18d, zn

Details for d2wgta_

PDB Entry: 2wgt (more details), 1.8 Å

PDB Description: structure of human adenovirus serotype 37 fibre head in complex with a sialic acid derivative, o-methyl 5-n-propaonyl-3,5-dideoxy-d- glycero-a-d-galacto-2-nonulopyranosylonic acid
PDB Compounds: (A:) fiber protein

SCOPe Domain Sequences for d2wgta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wgta_ b.21.1.1 (A:) automated matches {Human adenovirus 37 [TaxId: 52275]}
ydtrtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyhiinnktnpk
iksftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlvaypkpsnsk
kyardivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenvefettsftfs
yiaqe

SCOPe Domain Coordinates for d2wgta_:

Click to download the PDB-style file with coordinates for d2wgta_.
(The format of our PDB-style files is described here.)

Timeline for d2wgta_: