Class b: All beta proteins [48724] (180 folds) |
Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) |
Family b.21.1.1: Adenovirus fiber protein 'knob' domain [49836] (2 proteins) automatically mapped to Pfam PF00541 |
Protein automated matches [190333] (6 species) not a true protein |
Species Human adenovirus 37 [TaxId:52275] [188823] (4 PDB entries) |
Domain d2wgta_: 2wgt A: [169329] automated match to d1uxaa_ complexed with 18d, zn |
PDB Entry: 2wgt (more details), 1.8 Å
SCOPe Domain Sequences for d2wgta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wgta_ b.21.1.1 (A:) automated matches {Human adenovirus 37 [TaxId: 52275]} ydtrtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyhiinnktnpk iksftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlvaypkpsnsk kyardivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenvefettsftfs yiaqe
Timeline for d2wgta_: