Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.20: Hydroxynitrile lyase-like [53585] (3 proteins) automatically mapped to Pfam PF12697 |
Protein automated matches [191073] (1 species) not a true protein |
Species Rauvolfia serpentina [TaxId:4060] [188982] (3 PDB entries) |
Domain d2wflb_: 2wfl B: [169310] automated match to d1y7ha_ complexed with so4 |
PDB Entry: 2wfl (more details), 2.1 Å
SCOPe Domain Sequences for d2wflb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wflb_ c.69.1.20 (B:) automated matches {Rauvolfia serpentina [TaxId: 4060]} qqkhfvlvhggclgawiwyklkpllesaghkvtavdlsaaginprrldeihtfrdysepl mevmasippdekvvllghsfggmslglametypekisvavfmsammpdpnhsltypfeky nekcpadmmldsqfstygnpenpgmsmilgpqfmalkmfqncsvedlelakmltrpgslf fqdlakakkfsterygsvkrayifcnedksfpvefqkwfvesvgadkvkeikeadhmgml sqprevckclldisd
Timeline for d2wflb_: