Lineage for d2wflb_ (2wfl B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1002544Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1002545Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1003485Family c.69.1.20: Hydroxynitrile lyase-like [53585] (3 proteins)
  6. 1003538Protein automated matches [191073] (1 species)
    not a true protein
  7. 1003539Species Rauvolfia serpentina [TaxId:4060] [188982] (3 PDB entries)
  8. 1003541Domain d2wflb_: 2wfl B: [169310]
    automated match to d1y7ha_
    complexed with so4

Details for d2wflb_

PDB Entry: 2wfl (more details), 2.1 Å

PDB Description: crystal structure of polyneuridine aldehyde esterase
PDB Compounds: (B:) Polyneuridine-aldehyde esterase

SCOPe Domain Sequences for d2wflb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wflb_ c.69.1.20 (B:) automated matches {Rauvolfia serpentina [TaxId: 4060]}
qqkhfvlvhggclgawiwyklkpllesaghkvtavdlsaaginprrldeihtfrdysepl
mevmasippdekvvllghsfggmslglametypekisvavfmsammpdpnhsltypfeky
nekcpadmmldsqfstygnpenpgmsmilgpqfmalkmfqncsvedlelakmltrpgslf
fqdlakakkfsterygsvkrayifcnedksfpvefqkwfvesvgadkvkeikeadhmgml
sqprevckclldisd

SCOPe Domain Coordinates for d2wflb_:

Click to download the PDB-style file with coordinates for d2wflb_.
(The format of our PDB-style files is described here.)

Timeline for d2wflb_: