| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) ![]() less regular structure consisting of variable repeats |
| Family c.10.2.0: automated matches [191489] (1 protein) not a true family |
| Protein automated matches [190787] (10 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188042] (11 PDB entries) |
| Domain d2wfhb_: 2wfh B: [169306] automated match to d1w8aa_ complexed with so4 |
PDB Entry: 2wfh (more details), 1.8 Å
SCOPe Domain Sequences for d2wfhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wfhb_ c.10.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cptectcldtvvrcsnkglkvlpkgiprdvtelyldgnqftlvpkelsnykhltlidlsn
nristlsnqsfsnmtqlltlilsynrlrcipprtfdglkslrllslhgndisvvpegafn
dlsalshlaiganplycdcnmqwlsdwvkseykepgiarcagpgemadklllttpskkft
c
Timeline for d2wfhb_: