SCOPe 2.01: Domain d2wfcb_: 2wfc B:

Lineage for d2wfcb_ (2wfc B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein automated matches [190100] (8 species)
   not a true protein

7. Species Arenicola marina [TaxId:6344] [188412] (4 PDB entries)

8. Domain d2wfcb_: 2wfc B: [169302]
   automated match to d1urma_
   complexed with act

Details for d2wfcb_

PDB Entry: 2wfc, 1.75 Å

PDB Description: crystal structure of peroxiredoxin 5 from arenicola marina

PDB Compounds: (B:) peroxiredoxin 5

SCOPe Domain Sequences for d2wfcb_:

Sequence; same for both SEQRES and ATOM records:

>d2wfcb_ c.47.1.10 (B:) automated matches {Arenicola marina [TaxId: 6344]}
pikegdklpavtvfgatpndkvnmaelfagkkgvlfavpgaftpgsskthlpgyveqaaa
ihgkgvdiiacmavndsfvmdawgkahgaddkvqmladpggaftkavdmeldlsavlgnv
rskryslviedgvvtkvnvepdgkgltcslapnilsqlg

Timeline for d2wfcb_:

• d2wfcb_ is new in SCOPe 2.01-stable
  
• d2wfcb_ appears in SCOPe 2.02
  
• d2wfcb_ appears in the current release, SCOPe 2.08, called d2wfcb1