Lineage for d1bs2a1 (1bs2 A:484-607)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487290Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 1487291Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 1487292Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins)
  6. 1487293Protein Arginyl-tRNA synthetase (ArgRS) [47333] (2 species)
  7. 1487294Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47334] (3 PDB entries)
  8. 1487297Domain d1bs2a1: 1bs2 A:484-607 [16930]
    Other proteins in same PDB: d1bs2a2, d1bs2a3
    complexed with arg

Details for d1bs2a1

PDB Entry: 1bs2 (more details), 2.75 Å

PDB Description: yeast arginyl-trna synthetase
PDB Compounds: (A:) protein (arginyl-tRNA synthetase)

SCOPe Domain Sequences for d1bs2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bs2a1 a.27.1.1 (A:484-607) Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dtgpylqyahsrlrsvernasgitqekwinadfsllkepaakllirllgqypdvlrnaik
thepttvvtylfklthqvsscydvlwvagqteelatarlalygaarqvlyngmrllgltp
verm

SCOPe Domain Coordinates for d1bs2a1:

Click to download the PDB-style file with coordinates for d1bs2a1.
(The format of our PDB-style files is described here.)

Timeline for d1bs2a1: