SCOP 1.65: Domain d1bs2a1: 1bs2 A:484-607

Lineage for d1bs2a1 (1bs2 A:484-607)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
   core: 4 helices; bundle; one loop crosses over one side of the bundle

4. Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (1 family)

5. Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins)

6. Protein Arginyl-tRNA synthetase (ArgRS) [47333] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47334] (3 PDB entries)

8. Domain d1bs2a1: 1bs2 A:484-607 [16930]
   Other proteins in same PDB: d1bs2a2, d1bs2a3

Details for d1bs2a1

PDB Entry: 1bs2, 2.75 Å

PDB Description: yeast arginyl-trna synthetase

SCOP Domain Sequences for d1bs2a1:

Sequence; same for both SEQRES and ATOM records:

>d1bs2a1 a.27.1.1 (A:484-607) Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Saccharomyces cerevisiae)}
dtgpylqyahsrlrsvernasgitqekwinadfsllkepaakllirllgqypdvlrnaik
thepttvvtylfklthqvsscydvlwvagqteelatarlalygaarqvlyngmrllgltp
verm

Timeline for d1bs2a1:

• d1bs2a1 first appeared (with stable ids) in SCOP 1.55
  
• d1bs2a1 appears in SCOP 1.63
  
• d1bs2a1 appears in SCOP 1.67
  
• d1bs2a1 appears in the current release, SCOPe 2.08