![]() | Class a: All alpha proteins [46456] (144 folds) |
![]() | Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) |
![]() | Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (1 family) ![]() |
![]() | Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (4 proteins) |
![]() | Protein Arginyl-tRNA synthetase (ArgRS) [47333] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47334] (3 PDB entries) |
![]() | Domain d1bs2a1: 1bs2 A:484-607 [16930] Other proteins in same PDB: d1bs2a2, d1bs2a3 |
PDB Entry: 1bs2 (more details), 2.75 Å
SCOP Domain Sequences for d1bs2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bs2a1 a.27.1.1 (A:484-607) Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Saccharomyces cerevisiae)} dtgpylqyahsrlrsvernasgitqekwinadfsllkepaakllirllgqypdvlrnaik thepttvvtylfklthqvsscydvlwvagqteelatarlalygaarqvlyngmrllgltp verm
Timeline for d1bs2a1: