Lineage for d1bs2a1 (1bs2 A:484-607)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2808Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
  4. 2809Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (1 family) (S)
  5. 2810Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (4 proteins)
  6. 2811Protein Arginyl-tRNA synthetase (ArgRS) [47333] (1 species)
  7. 2812Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47334] (1 PDB entry)
  8. 2813Domain d1bs2a1: 1bs2 A:484-607 [16930]
    Other proteins in same PDB: d1bs2a2, d1bs2a3

Details for d1bs2a1

PDB Entry: 1bs2 (more details), 2.75 Å

PDB Description: yeast arginyl-trna synthetase

SCOP Domain Sequences for d1bs2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bs2a1 a.27.1.1 (A:484-607) Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Saccharomyces cerevisiae)}
dtgpylqyahsrlrsvernasgitqekwinadfsllkepaakllirllgqypdvlrnaik
thepttvvtylfklthqvsscydvlwvagqteelatarlalygaarqvlyngmrllgltp
verm

SCOP Domain Coordinates for d1bs2a1:

Click to download the PDB-style file with coordinates for d1bs2a1.
(The format of our PDB-style files is described here.)

Timeline for d1bs2a1: