Class a: All alpha proteins [46456] (290 folds) |
Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) core: 4 helices; bundle; one loop crosses over one side of the bundle |
Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) |
Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins) |
Protein Arginyl-tRNA synthetase (ArgRS) [47333] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47334] (3 PDB entries) |
Domain d1bs2a1: 1bs2 A:484-607 [16930] Other proteins in same PDB: d1bs2a2, d1bs2a3 complexed with arg |
PDB Entry: 1bs2 (more details), 2.75 Å
SCOPe Domain Sequences for d1bs2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bs2a1 a.27.1.1 (A:484-607) Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} dtgpylqyahsrlrsvernasgitqekwinadfsllkepaakllirllgqypdvlrnaik thepttvvtylfklthqvsscydvlwvagqteelatarlalygaarqvlyngmrllgltp verm
Timeline for d1bs2a1: