Lineage for d2wf9a_ (2wf9 A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1187611Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1187612Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1187730Family c.108.1.6: beta-Phosphoglucomutase-like [75173] (10 proteins)
    the insertion subdomain is a 4-helical bundle
  6. 1187731Protein beta-Phosphoglucomutase [75174] (2 species)
  7. 1187732Species Lactococcus lactis [TaxId:1358] [75175] (13 PDB entries)
  8. 1187739Domain d2wf9a_: 2wf9 A: [169298]
    automated match to d1lvha_
    complexed with bef, bg6, g6p, mg, na

Details for d2wf9a_

PDB Entry: 2wf9 (more details), 1.4 Å

PDB Description: structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate, and beryllium trifluoride, crystal form 2
PDB Compounds: (A:) beta-phosphoglucomutase

SCOPe Domain Sequences for d2wf9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wf9a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]}
mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
sgalpigvgrpedlgddivivpdtshytleflkevwlqkqk

SCOPe Domain Coordinates for d2wf9a_:

Click to download the PDB-style file with coordinates for d2wf9a_.
(The format of our PDB-style files is described here.)

Timeline for d2wf9a_: