| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
| Family c.108.1.6: beta-Phosphoglucomutase-like [75173] (10 proteins) the insertion subdomain is a 4-helical bundle |
| Protein beta-Phosphoglucomutase [75174] (3 species) |
| Species Lactococcus lactis [TaxId:1358] [75175] (22 PDB entries) |
| Domain d2wf9a_: 2wf9 A: [169298] automated match to d1lvha_ complexed with bef, bg6, g6p, mg, na |
PDB Entry: 2wf9 (more details), 1.4 Å
SCOPe Domain Sequences for d2wf9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wf9a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]}
mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
sgalpigvgrpedlgddivivpdtshytleflkevwlqkqk
Timeline for d2wf9a_: