Lineage for d2wf1a_ (2wf1 A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1320913Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1320914Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1322142Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 1322829Protein automated matches [190156] (4 species)
    not a true protein
  7. 1322854Species Human (Homo sapiens) [TaxId:9606] [187237] (36 PDB entries)
  8. 1322855Domain d2wf1a_: 2wf1 A: [169290]
    automated match to d1w50a_
    complexed with zy1

Details for d2wf1a_

PDB Entry: 2wf1 (more details), 1.6 Å

PDB Description: human bace-1 in complex with 7-ethyl-n-((1s,2r)-2-hydroxy-3-(((3- (methyloxy)phenyl(methyl)amino)-1-(phenylmethyl)propyl)-1-methyl-3,4- dihydro-1h-(1,2,5)thiadiazepino(3,4,5-hi)indole-9-carboxamide 2,2- dioxide
PDB Compounds: (A:) Beta-secretase 1

SCOPe Domain Sequences for d2wf1a_:

Sequence, based on SEQRES records: (download)

>d2wf1a_ b.50.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
emvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqlssty
rdlrkgvyvpytqgkwegelgtdlvsiphgpqvtvraniaaitesdkffiqgsnwegilg
layaeiarpddslepffdslvkqthvpnlfslqlcgagfplqqsevlasvggsmiiggid
hslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpkkv
feaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtqqsfriti
lpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsach
vhdefrtaavegpfvtldmedcgyni

Sequence, based on observed residues (ATOM records): (download)

>d2wf1a_ b.50.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
emvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqlssty
rdlrkgvyvpytqgkwegelgtdlvsiphgpqvtvraniaaitesdkffiqgsnwegilg
layaeiarpddslepffdslvkqthvpnlfslqlcgasvggsmiiggidhslytgslwyt
pirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpkkvfeaavksikaa
sstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtqqsfritilpqqylrpved
vatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsachvhdefrtaave
gpfvtldmedcgyni

SCOPe Domain Coordinates for d2wf1a_:

Click to download the PDB-style file with coordinates for d2wf1a_.
(The format of our PDB-style files is described here.)

Timeline for d2wf1a_: