SCOP 1.59: Domain d1gaxb1: 1gax B:579-862

Lineage for d1gaxb1 (1gax B:579-862)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)

4. Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (1 family)

5. Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (4 proteins)

6. Protein Valyl-tRNA synthetase (ValRS) [47331] (1 species)

7. Species Thermus thermophilus [TaxId:274] [47332] (1 PDB entry)

8. Domain d1gaxb1: 1gax B:579-862 [16929]
   Other proteins in same PDB: d1gaxa2, d1gaxa3, d1gaxb2, d1gaxb3

Details for d1gaxb1

PDB Entry: 1gax, 2.9 Å

PDB Description: crystal structure of thermus thermophilus valyl-trna synthetase complexed with trna(val) and valyl-adenylate analogue

SCOP Domain Sequences for d1gaxb1:

Sequence; same for both SEQRES and ATOM records:

>d1gaxb1 a.27.1.1 (B:579-862) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus}
anklynaarfvllsregfqakedtptladrfmrsrlsrgveeitalyealdlaqaarevy
elvwsefcdwyleaakpalkagnahtlrtleevlavllkllhpmmpfltselyqaltgke
elaleawpepggrdeeaerafealkqavtavralkaeaglppaqevrvylegetapveen
levfrflsradllperpakalvkamprvtarmpleglldveewrrrqekrlkellalaer
sqrklaspgfrekapkevveaeearlkenleqaerirealsqig

Timeline for d1gaxb1:

• d1gaxb1 first appeared (with stable ids) in SCOP 1.55
  
• d1gaxb1 appears in SCOP 1.57
  
• d1gaxb1 last appears in SCOP 1.61