Class a: All alpha proteins [46456] (284 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Calmodulin [47516] (11 species) |
Species African frog (Xenopus laevis) [TaxId:8355] [47521] (39 PDB entries) |
Domain d2weld_: 2wel D: [169276] automated match to d1cfca_ complexed with ca, edo, k88, po4 |
PDB Entry: 2wel (more details), 1.9 Å
SCOPe Domain Sequences for d2weld_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2weld_ a.39.1.5 (D:) Calmodulin {African frog (Xenopus laevis) [TaxId: 8355]} dqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgng tidfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeev demireadidgdgqvnyeefvqmmt
Timeline for d2weld_: