SCOPe 2.03: Domain d1qu3a1: 1qu3 A:645-881

Lineage for d1qu3a1 (1qu3 A:645-881)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
   core: 4 helices; bundle; one loop crosses over one side of the bundle

4. Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families)

5. Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins)

6. Protein Isoleucyl-tRNA synthetase (IleRS) [47328] (2 species)

7. Species Staphylococcus aureus [TaxId:1280] [47330] (3 PDB entries)
   contains additional alpha+beta and Zn-binding domains in the C-terminal extension

8. Domain d1qu3a1: 1qu3 A:645-881 [16927]
   Other proteins in same PDB: d1qu3a2, d1qu3a3
   protein/RNA complex; complexed with mrc, zn

Details for d1qu3a1

PDB Entry: 1qu3, 2.9 Å

PDB Description: insights into editing from an ile-trna synthetase structure with trna(ile) and mupirocin

PDB Compounds: (A:) isoleucyl-tRNA synthetase

SCOPe Domain Sequences for d1qu3a1:

Sequence; same for both SEQRES and ATOM records:

>d1qu3a1 a.27.1.1 (A:645-881) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus [TaxId: 1280]}
yrkirntlrfmlgnindfnpdtdsipesellevdryllnrlreftastinnyenfdylni
yqevqnfinvelsnfyldygkdilyieqrdshirrsmqtvlyqilvdmtkllapilvhta
eevwshtphvkeesvhladmpkvvevdqalldkwrtfmnlrddvnraletarnekvigks
leakvtiasndkfnasefltsfdalhqlfivsqvkvvdklddqatayehgdivieha

Timeline for d1qu3a1:

• d1qu3a1 first appeared (with stable ids) in SCOP 1.55
  
• d1qu3a1 appears in SCOPe 2.02
  
• d1qu3a1 appears in SCOPe 2.04
  
• d1qu3a1 appears in the current release, SCOPe 2.08