Lineage for d1qu3a1 (1qu3 A:645-881)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1266734Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 1266735Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 1266736Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins)
  6. 1266751Protein Isoleucyl-tRNA synthetase (IleRS) [47328] (2 species)
  7. 1266752Species Staphylococcus aureus [TaxId:1280] [47330] (3 PDB entries)
    contains additional alpha+beta and Zn-binding domains in the C-terminal extension
  8. 1266755Domain d1qu3a1: 1qu3 A:645-881 [16927]
    Other proteins in same PDB: d1qu3a2, d1qu3a3
    protein/RNA complex; complexed with mrc, zn

Details for d1qu3a1

PDB Entry: 1qu3 (more details), 2.9 Å

PDB Description: insights into editing from an ile-trna synthetase structure with trna(ile) and mupirocin
PDB Compounds: (A:) isoleucyl-tRNA synthetase

SCOPe Domain Sequences for d1qu3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qu3a1 a.27.1.1 (A:645-881) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus [TaxId: 1280]}
yrkirntlrfmlgnindfnpdtdsipesellevdryllnrlreftastinnyenfdylni
yqevqnfinvelsnfyldygkdilyieqrdshirrsmqtvlyqilvdmtkllapilvhta
eevwshtphvkeesvhladmpkvvevdqalldkwrtfmnlrddvnraletarnekvigks
leakvtiasndkfnasefltsfdalhqlfivsqvkvvdklddqatayehgdivieha

SCOPe Domain Coordinates for d1qu3a1:

Click to download the PDB-style file with coordinates for d1qu3a1.
(The format of our PDB-style files is described here.)

Timeline for d1qu3a1: