Class a: All alpha proteins [46456] (144 folds) |
Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) |
Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (1 family) |
Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (4 proteins) |
Protein Isoleucyl-tRNA synthetase (IleRS) [47328] (2 species) |
Species Staphylococcus aureus [TaxId:1280] [47330] (3 PDB entries) |
Domain d1qu3a1: 1qu3 A:645-881 [16927] Other proteins in same PDB: d1qu3a2, d1qu3a3 |
PDB Entry: 1qu3 (more details), 2.9 Å
SCOP Domain Sequences for d1qu3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qu3a1 a.27.1.1 (A:645-881) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus} yrkirntlrfmlgnindfnpdtdsipesellevdryllnrlreftastinnyenfdylni yqevqnfinvelsnfyldygkdilyieqrdshirrsmqtvlyqilvdmtkllapilvhta eevwshtphvkeesvhladmpkvvevdqalldkwrtfmnlrddvnraletarnekvigks leakvtiasndkfnasefltsfdalhqlfivsqvkvvdklddqatayehgdivieha
Timeline for d1qu3a1: