Lineage for d1qu3a1 (1qu3 A:645-881)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47121Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
  4. 47122Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (1 family) (S)
  5. 47123Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (4 proteins)
  6. 47129Protein Isoleucyl-tRNA synthetase (IleRS) [47328] (2 species)
  7. 47130Species Staphylococcus aureus [TaxId:1280] [47330] (3 PDB entries)
  8. 47133Domain d1qu3a1: 1qu3 A:645-881 [16927]
    Other proteins in same PDB: d1qu3a2, d1qu3a3

Details for d1qu3a1

PDB Entry: 1qu3 (more details), 2.9 Å

PDB Description: insights into editing from an ile-trna synthetase structure with trna(ile) and mupirocin

SCOP Domain Sequences for d1qu3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qu3a1 a.27.1.1 (A:645-881) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus}
yrkirntlrfmlgnindfnpdtdsipesellevdryllnrlreftastinnyenfdylni
yqevqnfinvelsnfyldygkdilyieqrdshirrsmqtvlyqilvdmtkllapilvhta
eevwshtphvkeesvhladmpkvvevdqalldkwrtfmnlrddvnraletarnekvigks
leakvtiasndkfnasefltsfdalhqlfivsqvkvvdklddqatayehgdivieha

SCOP Domain Coordinates for d1qu3a1:

Click to download the PDB-style file with coordinates for d1qu3a1.
(The format of our PDB-style files is described here.)

Timeline for d1qu3a1: