Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.73: Carbamate kinase-like [53632] (1 superfamily) 3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest |
Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase |
Family c.73.1.1: Carbamate kinase [53634] (1 protein) automatically mapped to Pfam PF00696 |
Protein Carbamate kinase [53635] (3 species) |
Species Enterococcus faecalis [TaxId:1351] [189279] (2 PDB entries) |
Domain d2we5b_: 2we5 B: [169268] automated match to d1b7ba_ complexed with act, adp, mg |
PDB Entry: 2we5 (more details), 1.39 Å
SCOPe Domain Sequences for d2we5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2we5b_ c.73.1.1 (B:) Carbamate kinase {Enterococcus faecalis [TaxId: 1351]} gkkmvvalggnailsndasahaqqqalvqtsaylvhlikqghrlivshgngpqvgnlllq qqaadseknpampldtcvamtqgsigywlsnalnqelnkagikkqvatvltqvvvdpade afknptkpigpflteaeakeamqagaifkedagrgwrkvvpspkpidiheaetintlikn diitiscggggipvvgqelkgveavidkdfaseklaelvdadalviltgvdyvcinygkp dekqltnvtvaeleeykqaghfapgsmlpkieaaiqfvesqpnkqaiitslenlgsmsgd eivgtvvtk
Timeline for d2we5b_: