SCOPe 2.05: Domain d2we4d_: 2we4 D:

Lineage for d2we4d_ (2we4 D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest

4. Superfamily c.73.1: Carbamate kinase-like [53633] (4 families)
   the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase

5. Family c.73.1.1: Carbamate kinase [53634] (1 protein)
   automatically mapped to Pfam PF00696

6. Protein Carbamate kinase [53635] (3 species)

7. Species Enterococcus faecalis [TaxId:1351] [189279] (2 PDB entries)

8. Domain d2we4d_: 2we4 D: [169266]
   automated match to d1b7ba_
   complexed with so4

Details for d2we4d_

PDB Entry: 2we4, 2.02 Å

PDB Description: carbamate kinase from enterococcus faecalis bound to a sulfate ion and two water molecules, which mimic the substrate carbamyl phosphate

PDB Compounds: (D:) carbamate kinase 1

SCOPe Domain Sequences for d2we4d_:

Sequence; same for both SEQRES and ATOM records:

>d2we4d_ c.73.1.1 (D:) Carbamate kinase {Enterococcus faecalis [TaxId: 1351]}
gkkmvvalggnailsndasahaqqqalvqtsaylvhlikqghrlivshgngpqvgnlllq
qqaadseknpampldtcvamtqgsigywlsnalnqelnkagikkqvatvltqvvvdpade
afknptkpigpflteaeakeamqagaifkedagrgwrkvvpspkpidiheaetintlikn
diitiscggggipvvgqelkgveavidkdfaseklaelvdadalviltgvdyvcinygkp
dekqltnvtvaeleeykqaghfapgsmlpkieaaiqfvesqpnkqaiitslenlgsmsgd
eivgtvvtk

Timeline for d2we4d_:

• d2we4d_ first appeared in SCOPe 2.01
  
• d2we4d_ appears in SCOPe 2.04
  
• d2we4d_ appears in SCOPe 2.06
  
• d2we4d_ appears in the current release, SCOPe 2.08