Lineage for d2we4c_ (2we4 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905127Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 2905128Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 2905129Family c.73.1.1: Carbamate kinase [53634] (1 protein)
    automatically mapped to Pfam PF00696
  6. 2905130Protein Carbamate kinase [53635] (3 species)
  7. 2905131Species Enterococcus faecalis [TaxId:1351] [189279] (2 PDB entries)
  8. 2905137Domain d2we4c_: 2we4 C: [169265]
    automated match to d1b7ba_
    complexed with so4

Details for d2we4c_

PDB Entry: 2we4 (more details), 2.02 Å

PDB Description: carbamate kinase from enterococcus faecalis bound to a sulfate ion and two water molecules, which mimic the substrate carbamyl phosphate
PDB Compounds: (C:) carbamate kinase 1

SCOPe Domain Sequences for d2we4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2we4c_ c.73.1.1 (C:) Carbamate kinase {Enterococcus faecalis [TaxId: 1351]}
gkkmvvalggnailsndasahaqqqalvqtsaylvhlikqghrlivshgngpqvgnlllq
qqaadseknpampldtcvamtqgsigywlsnalnqelnkagikkqvatvltqvvvdpade
afknptkpigpflteaeakeamqagaifkedagrgwrkvvpspkpidiheaetintlikn
diitiscggggipvvgqelkgveavidkdfaseklaelvdadalviltgvdyvcinygkp
dekqltnvtvaeleeykqaghfapgsmlpkieaaiqfvesqpnkqaiitslenlgsmsgd
eivgtvvtk

SCOPe Domain Coordinates for d2we4c_:

Click to download the PDB-style file with coordinates for d2we4c_.
(The format of our PDB-style files is described here.)

Timeline for d2we4c_: