![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.73: Carbamate kinase-like [53632] (1 superfamily) 3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest |
![]() | Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) ![]() the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase |
![]() | Family c.73.1.1: Carbamate kinase [53634] (1 protein) automatically mapped to Pfam PF00696 |
![]() | Protein Carbamate kinase [53635] (3 species) |
![]() | Species Enterococcus faecalis [TaxId:1351] [189279] (2 PDB entries) |
![]() | Domain d2we4b_: 2we4 B: [169264] automated match to d1b7ba_ complexed with so4 |
PDB Entry: 2we4 (more details), 2.02 Å
SCOPe Domain Sequences for d2we4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2we4b_ c.73.1.1 (B:) Carbamate kinase {Enterococcus faecalis [TaxId: 1351]} gkkmvvalggnailsndasahaqqqalvqtsaylvhlikqghrlivshgngpqvgnlllq qqaadseknpampldtcvamtqgsigywlsnalnqelnkagikkqvatvltqvvvdpade afknptkpigpflteaeakeamqagaifkedagrgwrkvvpspkpidiheaetintlikn diitiscggggipvvgqelkgveavidkdfaseklaelvdadalviltgvdyvcinygkp dekqltnvtvaeleeykqaghfapgsmlpkieaaiqfvesqpnkqaiitslenlgsmsgd eivgtvvtk
Timeline for d2we4b_: