Lineage for d2wdzd_ (2wdz D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848346Species Rhodobacter sphaeroides [TaxId:1063] [189314] (3 PDB entries)
  8. 2848358Domain d2wdzd_: 2wdz D: [169262]
    automated match to d1vl8b_
    complexed with 1sp, mg, nad

Details for d2wdzd_

PDB Entry: 2wdz (more details), 1.95 Å

PDB Description: crystal structure of the short chain dehydrogenase galactitol-dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with nad+ and 1,2-pentandiol
PDB Compounds: (D:) short-chain dehydrogenase/reductase

SCOPe Domain Sequences for d2wdzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wdzd_ c.2.1.0 (D:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
mdyrtvfrldgacaavtgagsgigleicrafaasgarlilidreaaaldraaqelgaava
arivadvtdaeamtaaaaeaeavapvsilvnsagiarlhdaletddatwrqvmavnvdgm
fwasrafgramvargagaivnlgsmsgtivnrpqfassymaskgavhqltralaaewagr
gvrvnalapgyvatemtlkmrerpelfetwldmtpmgrcgepseiaaaalflaspaasyv
tgailavdggytvw

SCOPe Domain Coordinates for d2wdzd_:

Click to download the PDB-style file with coordinates for d2wdzd_.
(The format of our PDB-style files is described here.)

Timeline for d2wdzd_: