Lineage for d1ffya1 (1ffy A:645-917)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47121Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
  4. 47122Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (1 family) (S)
  5. 47123Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (4 proteins)
  6. 47129Protein Isoleucyl-tRNA synthetase (IleRS) [47328] (2 species)
  7. 47130Species Staphylococcus aureus [TaxId:1280] [47330] (3 PDB entries)
  8. 47131Domain d1ffya1: 1ffy A:645-917 [16926]
    Other proteins in same PDB: d1ffya2, d1ffya3

Details for d1ffya1

PDB Entry: 1ffy (more details), 2.2 Å

PDB Description: insights into editing from an ile-trna synthetase structure with trna(ile) and mupirocin

SCOP Domain Sequences for d1ffya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffya1 a.27.1.1 (A:645-917) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus}
yrkirntlrfmlgnindfnpdtdsipesellevdryllnrlreftastinnyenfdylni
yqevqnfinvelsnfyldygkdilyieqrdshirrsmqtvlyqilvdmtkllapilvhta
eevwshtphvkeesvhladmpkvvevdqalldkwrtfmnlrddvnraletarnekvigks
leakvtiasndkfnasefltsfdalhqlfivsqvkvvdklddqatayehgdiviehadge
kcercwnysedlgavdelthlcprcqqvvkslv

SCOP Domain Coordinates for d1ffya1:

Click to download the PDB-style file with coordinates for d1ffya1.
(The format of our PDB-style files is described here.)

Timeline for d1ffya1: