Lineage for d2wdza_ (2wdz A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 975118Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 975119Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 978249Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 978250Protein automated matches [190069] (51 species)
    not a true protein
  7. 978463Species Rhodobacter sphaeroides [TaxId:1063] [189314] (2 PDB entries)
  8. 978468Domain d2wdza_: 2wdz A: [169259]
    automated match to d1vl8b_
    complexed with 1sp, mg, nad

Details for d2wdza_

PDB Entry: 2wdz (more details), 1.95 Å

PDB Description: crystal structure of the short chain dehydrogenase galactitol-dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with nad+ and 1,2-pentandiol
PDB Compounds: (A:) short-chain dehydrogenase/reductase

SCOPe Domain Sequences for d2wdza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wdza_ c.2.1.0 (A:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
mdyrtvfrldgacaavtgagsgigleicrafaasgarlilidreaaaldraaqelgaava
arivadvtdaeamtaaaaeaeavapvsilvnsagiarlhdaletddatwrqvmavnvdgm
fwasrafgramvargagaivnlgsmsgtivnrpqfassymaskgavhqltralaaewagr
gvrvnalapgyvatemtlkmrerpelfetwldmtpmgrcgepseiaaaalflaspaasyv
tgailavdggytvw

SCOPe Domain Coordinates for d2wdza_:

Click to download the PDB-style file with coordinates for d2wdza_.
(The format of our PDB-style files is described here.)

Timeline for d2wdza_: