SCOPe 2.08: Domain d2wdtc_: 2wdt C:

Lineage for d2wdtc_ (2wdt C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.0: automated matches [191342] (1 protein)
   not a true family

6. Protein automated matches [190230] (23 species)
   not a true protein

7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [189172] (2 PDB entries)

8. Domain d2wdtc_: 2wdt C: [169257]
   Other proteins in same PDB: d2wdtb1, d2wdtb2, d2wdtd1, d2wdtd2
   automated match to d1ucha_
   complexed with cl

Details for d2wdtc_

PDB Entry: 2wdt, 2.3 Å

PDB Description: crystal structure of plasmodium falciparum uchl3 in complex with the suicide inhibitor ubvme

PDB Compounds: (C:) ubiquitin carboxyl-terminal hydrolase l3

SCOPe Domain Sequences for d2wdtc_:

Sequence, based on SEQRES records:

>d2wdtc_ d.3.1.0 (C:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
ndiwtplesnpdslylyscklgqsklkfvdiygfnndlldmipqpvqaviflypvndniv
senntndkhnlkenfdnvwfikqyipnscgtiallhlygnlrnkfeldkdsvlddffnkv
nemsaekrgqelknnksienlhhefcgqvenrddildvdthfivfvqiegkiieldgrkd
hptvhcftngdnflydtgkiiqdkfiekckddlrfsalavipnd

Sequence, based on observed residues (ATOM records):

>d2wdtc_ d.3.1.0 (C:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
ndiwtplesnpdslylyscklgqsklkfvdiygfnndlldmipqpvqaviflypvnfdnv
wfikqyipnscgtiallhlygnlrnkfeldkdsvlddffnkvnemsaekrgqelknnksi
enlhhefcgqvenrddildvdthfivfvqiegkiieldgrkdhptvhcftngdnflydtg
kiiqdkfiekckddlrfsalavipnd

Timeline for d2wdtc_:

• d2wdtc_ first appeared in SCOPe 2.01
  
• d2wdtc_ appears in SCOPe 2.07