Lineage for d2wdta_ (2wdt A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1398964Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1398965Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1399697Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 1399698Protein automated matches [190230] (14 species)
    not a true protein
  7. 1399768Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [189172] (2 PDB entries)
  8. 1399769Domain d2wdta_: 2wdt A: [169255]
    Other proteins in same PDB: d2wdtb_, d2wdtd_
    automated match to d1ucha_
    complexed with cl

Details for d2wdta_

PDB Entry: 2wdt (more details), 2.3 Å

PDB Description: crystal structure of plasmodium falciparum uchl3 in complex with the suicide inhibitor ubvme
PDB Compounds: (A:) ubiquitin carboxyl-terminal hydrolase l3

SCOPe Domain Sequences for d2wdta_:

Sequence, based on SEQRES records: (download)

>d2wdta_ d.3.1.0 (A:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
diwtplesnpdslylyscklgqsklkfvdiygfnndlldmipqpvqaviflypvndnivs
enntndkhnlkenfdnvwfikqyipnscgtiallhlygnlrnkfeldkdsvlddffnkvn
emsaekrgqelknnksienlhhefcgqvenrddildvdthfivfvqiegkiieldgrkdh
ptvhcftngdnflydtgkiiqdkfiekckddlrfsalavipn

Sequence, based on observed residues (ATOM records): (download)

>d2wdta_ d.3.1.0 (A:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
diwtplesnpdslylyscklgqsklkfvdiygfnndlldmipqpvqaviflypvnfdnvw
fikqyipnscgtiallhlygnlrnkfeldkdsvlddffnkvnemsaekrgqelknnksie
nlhhefcgqvenrddildvdthfivfvqiegkiieldgrkdhptvhcftngdnflydtgk
iiqdkfiekckddlrfsalavipn

SCOPe Domain Coordinates for d2wdta_:

Click to download the PDB-style file with coordinates for d2wdta_.
(The format of our PDB-style files is described here.)

Timeline for d2wdta_: