![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.0: automated matches [191342] (1 protein) not a true family |
![]() | Protein automated matches [190230] (23 species) not a true protein |
![]() | Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [189172] (2 PDB entries) |
![]() | Domain d2wdta_: 2wdt A: [169255] Other proteins in same PDB: d2wdtb1, d2wdtb2, d2wdtd1, d2wdtd2 automated match to d1ucha_ complexed with cl |
PDB Entry: 2wdt (more details), 2.3 Å
SCOPe Domain Sequences for d2wdta_:
Sequence, based on SEQRES records: (download)
>d2wdta_ d.3.1.0 (A:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} diwtplesnpdslylyscklgqsklkfvdiygfnndlldmipqpvqaviflypvndnivs enntndkhnlkenfdnvwfikqyipnscgtiallhlygnlrnkfeldkdsvlddffnkvn emsaekrgqelknnksienlhhefcgqvenrddildvdthfivfvqiegkiieldgrkdh ptvhcftngdnflydtgkiiqdkfiekckddlrfsalavipn
>d2wdta_ d.3.1.0 (A:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} diwtplesnpdslylyscklgqsklkfvdiygfnndlldmipqpvqaviflypvnfdnvw fikqyipnscgtiallhlygnlrnkfeldkdsvlddffnkvnemsaekrgqelknnksie nlhhefcgqvenrddildvdthfivfvqiegkiieldgrkdhptvhcftngdnflydtgk iiqdkfiekckddlrfsalavipn
Timeline for d2wdta_: