SCOP 1.59: Domain d1qu2a1: 1qu2 A:645-917

Lineage for d1qu2a1 (1qu2 A:645-917)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)

4. Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (1 family)

5. Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (4 proteins)

6. Protein Isoleucyl-tRNA synthetase (IleRS) [47328] (2 species)

7. Species Staphylococcus aureus [TaxId:1280] [47330] (3 PDB entries)

8. Domain d1qu2a1: 1qu2 A:645-917 [16925]
   Other proteins in same PDB: d1qu2a2, d1qu2a3

Details for d1qu2a1

PDB Entry: 1qu2, 2.2 Å

PDB Description: insights into editing from an ile-trna synthetase structure with trna(ile) and mupirocin

SCOP Domain Sequences for d1qu2a1:

Sequence; same for both SEQRES and ATOM records:

>d1qu2a1 a.27.1.1 (A:645-917) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus}
yrkirntlrfmlgnindfnpdtdsipesellevdryllnrlreftastinnyenfdylni
yqevqnfinvelsnfyldygkdilyieqrdshirrsmqtvlyqilvdmtkllapilvhta
eevwshtphvkeesvhladmpkvvevdqalldkwrtfmnlrddvnraletarnekvigks
leakvtiasndkfnasefltsfdalhqlfivsqvkvvdklddqatayehgdiviehadge
kcercwnysedlgavdelthlcprcqqvvkslv

Timeline for d1qu2a1:

• d1qu2a1 first appeared (with stable ids) in SCOP 1.55
  
• d1qu2a1 appears in SCOP 1.57
  
• d1qu2a1 appears in SCOP 1.61
  
• d1qu2a1 appears in the current release, SCOPe 2.08