Lineage for d2wd7c_ (2wd7 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842913Protein automated matches [190085] (59 species)
    not a true protein
  7. 2843489Species Trypanosoma brucei [TaxId:5702] [187520] (4 PDB entries)
  8. 2843496Domain d2wd7c_: 2wd7 C: [169246]
    automated match to d1mxfa_
    complexed with nap, vgd

Details for d2wd7c_

PDB Entry: 2wd7 (more details), 1.9 Å

PDB Description: pteridine reductase 1 (ptr1) from trypanosoma brucei in complex with nadp and ddd00066750
PDB Compounds: (C:) pteridine reductase

SCOPe Domain Sequences for d2wd7c_:

Sequence, based on SEQRES records: (download)

>d2wd7c_ c.2.1.2 (C:) automated matches {Trypanosoma brucei [TaxId: 5702]}
eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqgdhednsngktvetqva
eligtnaiapflltmsfaqrqkgtnpnctssnlsivnlcdamvdqpcmafslynmgkhal
vgltqsaalelapygirvngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadav
iflvsgsaqyitgsiikvdgglslvha

Sequence, based on observed residues (ATOM records): (download)

>d2wd7c_ c.2.1.2 (C:) automated matches {Trypanosoma brucei [TaxId: 5702]}
eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvgktvetqvaeligtnaia
pflltmsfaqrqsnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapygirv
ngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadaviflvsgsaqyitgsiikv
dgglslvha

SCOPe Domain Coordinates for d2wd7c_:

Click to download the PDB-style file with coordinates for d2wd7c_.
(The format of our PDB-style files is described here.)

Timeline for d2wd7c_: