Lineage for d2wd4a_ (2wd4 A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 919407Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 919408Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 919409Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 919665Protein automated matches [190089] (4 species)
    not a true protein
  7. 919696Species Soybean (Glycine max) [TaxId:3847] [187116] (14 PDB entries)
  8. 919699Domain d2wd4a_: 2wd4 A: [169243]
    automated match to d1oafa_
    complexed with fe, na, so4, tbv

Details for d2wd4a_

PDB Entry: 2wd4 (more details), 1.4 Å

PDB Description: ascorbate peroxidase as a heme oxygenase: w41a variant product with t- butyl peroxide
PDB Compounds: (A:) ascorbate peroxidase

SCOPe Domain Sequences for d2wd4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wd4a_ a.93.1.1 (A:) automated matches {Soybean (Glycine max) [TaxId: 3847]}
gksyptvsadyqkavekakkklrgfiaekrcaplmlrlaahsagtfdkgtktggpfgtik
hpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgred
kpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwts
nplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahqk
lselgfad

SCOPe Domain Coordinates for d2wd4a_:

Click to download the PDB-style file with coordinates for d2wd4a_.
(The format of our PDB-style files is described here.)

Timeline for d2wd4a_: