Lineage for d2wd4a_ (2wd4 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2719959Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2720315Protein automated matches [190089] (9 species)
    not a true protein
  7. 2720367Species Soybean (Glycine max) [TaxId:3847] [187116] (17 PDB entries)
  8. 2720372Domain d2wd4a_: 2wd4 A: [169243]
    automated match to d1oafa_
    complexed with fe, na, so4, tbv

Details for d2wd4a_

PDB Entry: 2wd4 (more details), 1.4 Å

PDB Description: ascorbate peroxidase as a heme oxygenase: w41a variant product with t- butyl peroxide
PDB Compounds: (A:) ascorbate peroxidase

SCOPe Domain Sequences for d2wd4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wd4a_ a.93.1.1 (A:) automated matches {Soybean (Glycine max) [TaxId: 3847]}
gksyptvsadyqkavekakkklrgfiaekrcaplmlrlaahsagtfdkgtktggpfgtik
hpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgred
kpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwts
nplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahqk
lselgfad

SCOPe Domain Coordinates for d2wd4a_:

Click to download the PDB-style file with coordinates for d2wd4a_.
(The format of our PDB-style files is described here.)

Timeline for d2wd4a_: