SCOP 1.59: Domain d1ile_1: 1ile 642-821

Lineage for d1ile_1 (1ile 642-821)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)

4. Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (1 family)

5. Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (4 proteins)

6. Protein Isoleucyl-tRNA synthetase (IleRS) [47328] (2 species)

7. Species Thermus thermophilus [TaxId:274] [47329] (3 PDB entries)

8. Domain d1ile_1: 1ile 642-821 [16924]
   Other proteins in same PDB: d1ile_2, d1ile_3

Details for d1ile_1

PDB Entry: 1ile, 2.5 Å

PDB Description: isoleucyl-trna synthetase

SCOP Domain Sequences for d1ile_1:

Sequence; same for both SEQRES and ATOM records:

>d1ile_1 a.27.1.1 (642-821) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus}
yfltlwnvysffvtyanldrpdlknppppekrpemdrwllarmqdliqrvtealeaydpt
tsaralrdfvvedlsqwyvrrnrrrfwknedaldreaayatlyealvlvatlaapftpfl
aevlwqnlvrsvrleakesvhladwpeadpaladealvaqmravlkvvdlaraaraksgv

Timeline for d1ile_1:

• d1ile_1 first appeared (with stable ids) in SCOP 1.55
  
• d1ile_1 appears in SCOP 1.57
  
• d1ile_1 appears in SCOP 1.61
  
• d1ile_1 appears in the current release, SCOPe 2.08, called d1ilea1