Lineage for d2wcub_ (2wcu B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923177Fold c.133: RbsD-like [102545] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 251634; strand 6 is antiparallel to the rest
  4. 2923178Superfamily c.133.1: RbsD-like [102546] (2 families) (S)
  5. 2923205Family c.133.1.0: automated matches [191558] (1 protein)
    not a true family
  6. 2923206Protein automated matches [190962] (7 species)
    not a true protein
  7. 2923229Species Mouse (Mus musculus) [TaxId:10090] [189111] (1 PDB entry)
  8. 2923231Domain d2wcub_: 2wcu B: [169230]
    automated match to d2ob5a1
    complexed with fuc

Details for d2wcub_

PDB Entry: 2wcu (more details), 1.9 Å

PDB Description: crystal structure of mammalian fucu
PDB Compounds: (B:) protein fucu homolog

SCOPe Domain Sequences for d2wcub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wcub_ c.133.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mvalkgipkvlspellfalarmghgdeivladanfptssicqcgpveiradgldipqlle
avlrllpldtyvespaavmdlvpsdkekglqtpiwkryesllleadckktlmklerfefy
erakkafavvatgemalygniilkkgtld

SCOPe Domain Coordinates for d2wcub_:

Click to download the PDB-style file with coordinates for d2wcub_.
(The format of our PDB-style files is described here.)

Timeline for d2wcub_: