Lineage for d1qqta1 (1qqt A:389-548)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2808Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
  4. 2809Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (1 family) (S)
  5. 2810Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (4 proteins)
  6. 2821Protein Methionyl-tRNA synthetase (MetRS) [47325] (2 species)
  7. 2822Species Escherichia coli [TaxId:562] [47327] (1 PDB entry)
  8. 2823Domain d1qqta1: 1qqt A:389-548 [16923]
    Other proteins in same PDB: d1qqta2, d1qqta3

Details for d1qqta1

PDB Entry: 1qqt (more details), 2.03 Å

PDB Description: methionyl-trna synthetase from escherichia coli

SCOP Domain Sequences for d1qqta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qqta1 a.27.1.1 (A:389-548) Methionyl-tRNA synthetase (MetRS) {Escherichia coli}
vvnlasrnagfinkrfdgvlaseladpalyktftdaaevigeawesrefgkavreimala
dlanryvdeqapwvvakqagrdadlqaicsmginlfrvlmtylkpvlpklteraeaflnt
eltwdgiqqpllghkvnpfkalynridmrqvealveaske

SCOP Domain Coordinates for d1qqta1:

Click to download the PDB-style file with coordinates for d1qqta1.
(The format of our PDB-style files is described here.)

Timeline for d1qqta1: